PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma313g00020.1
Common NameZOSMA_313G00020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family HB-other
Protein Properties Length: 1585aa    MW: 180434 Da    PI: 6.0106
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma313g00020.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.8e-173589357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      kR   t+ qle Le++F + + ps+e+r+eL++kl Lt+rq ++WF+ rR kekk
  Zosma313g00020.1 35 KRKMKTPFQLEHLEKAFVEASFPSEETRAELSMKLALTDRQLQMWFCHRRLKEKK 89
                      89999*************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-152190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-162389IPR009057Homeodomain-like
PROSITE profilePS5007115.583090IPR001356Homeobox domain
SMARTSM003893.5E-133294IPR001356Homeobox domain
CDDcd000861.11E-123591No hitNo description
PfamPF000467.7E-153589IPR001356Homeobox domain
PROSITE profilePS5082717.206547606IPR018501DDT domain
SMARTSM005711.5E-22547606IPR018501DDT domain
PfamPF027914.4E-19548603IPR018501DDT domain
PfamPF050667.2E-15727794IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.1E-6929971IPR028942WHIM1 domain
PfamPF156131.2E-1110831154IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1585 aa     Download sequence    Send to blast
MEVSDEDGGG SDEKKTTPPY PTPAMVQPSN LQPAKRKMKT PFQLEHLEKA FVEASFPSEE  60
TRAELSMKLA LTDRQLQMWF CHRRLKEKKT NNMNAMIVPN SLPKRKASEN RYSHPPPRMM  120
DVKSPSPSKS PSPSQSPSSS PSHSPLLSHS SSSTPSPLAS PTSNNHKSAV SLESQTMLEH  180
AKIDSVMFML GNEFREDGPF LSTAFDSLPQ RAFGKFLERT EQQNLPEQQF HDENFLAINA  240
TNSYKAPSFV NSTENDYIPS SSSGKRKRKR KRRDHVLNVS CSQPRHGNHF PSEQLSIEAD  300
GNERLVPPHF YDKHTGGLSV HDDDQKNPCY NLNSQLAIKQ DSEHGVELEH KRVMWEEETR  360
LEKKRKIEDR RISKEISVHN KRLKKELEKQ ETLKRKRDEQ MRKEMERQDR EKKKEEDKLL  420
REKQREEERH QRELKRVHER REKVLQKENL RAEKIRIKEK IKKEKEAARI KAANERAAAR  480
KYMDLIEDER LELMNIAASS KGLTSITCLD DVTLQNLNTF QEMLKEFPPQ SVYLKQPFSV  540
RPWIDSNECI GNLLMVWNFL INFADVLSLW PFTLDEFVQA LHDYDSRLLS EIHISLLKFI  600
IKDIEDVVSS ISPGGNHNSA ANPGIGHSQV VVKEAYAWGF DIKIWENHLN HLTWPEILRQ  660
FALCAGFGPQ LRKYDETASH RNEDECHDSE DVISALRSGM AAENALSTMQ GKGSSHLRRK  720
RHILTPGTVK FAAFHVLSLE GSNGLTILEI ADKIQKSGLR DLTTSKTPEA SISAALSRDT  780
ELFARTAPST YCVQAAYRKD PSDADSILAT AREKMHMFES RYLEMEISEK DTEGIGGAER  840
DDPEIEGINP KIKFPDVQNQ CELNSVIKSN HTGNENDVSF DGVAIDSDSS AKIIDKASNL  900
DASNDHFHES TFEKGAKVDG SEIDESNPGE SWIQGLMDGE YSDISVEERL NALVSLVGVV  960
LEGNTIHVIL EERMKAVKIL KQQMLAEFQL DKKRMKENLC RLELSSLGKN SEMLQDNIAN  1020
MKSNDLKNPH NLKSIDTKRT MIGQGLKTNP NVSQLQHCRY FEKSLSQIKS YISRKAEQVH  1080
PYRSLPLGQD RRHNQYWQFI ASASKSDPGS GRIFFESRDG YWQLIDSEEA FDSLLAALDL  1140
RGIRESNLHS ELLNIESSFK ETVKMNKSFN PNCGLGLSSP DSAVSGLTVD PSDRSSSFYI  1200
ELGQNQMEQT CLMKRYQDFQ RWMWKNCFNS AVLCAIKIGR RRCPEMLEIC NFCFNTYFSE  1260
DKHCSSCHTT FKNRYNFEVI FSEHVACCEQ RVDSGCTLDC SKSSLPIRFQ MLKMQLSRIE  1320
ASIPTEALLP FWTDFYRKSW SVKLQLSSSA EDLFQILTIL ESAIKRDCLS PNFDTTNELL  1380
GNSLPVNSMD KVEFDSLVVK VLPWIPHTTA AVVLRLMELD GSIFYDLDLK HNSLKEGYSD  1440
KLIELPSSNS VVNGIVDSEH METVGHDDDH FSECDRTDPQ AKHTATRVLS SRGRGVRKRG  1500
HDGKSILKEE KTKELNGMES VDNDEVYGDE YDDEYYGRKH VLADSESQED SVGDDEADMD  1560
YRNEVMMNDD DIDNESYASS DDSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1264272KRKRKRKRR
2265273RKRKRKRRD
3266272KRKRKRR
4267272RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008811888.10.0PREDICTED: uncharacterized protein LOC103722930 isoform X2
TrEMBLA0A0K9PBP40.0A0A0K9PBP4_Z
STRINGGSMUA_Achr9P06610_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22833352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator